PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.8819s0128.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 319aa    MW: 35404.8 Da    PI: 5.852
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.8819s0128.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.54e-1752111256
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                          ++R+++++eq+++Le+ F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k
  Bostr.8819s0128.1.p  52 KPRWNPKPEQIRILESIFNSgIVNPPRDEIQRIRIRLqeygQIGDANVFYWFQNRKSRAK 111
                          89*****************99************************************998 PP

2Wus_type_Homeobox109.32.1e-3551113264
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          +++RW+P+peQi+iLe++++sG+++P+++eiqri+ +L+eyG+i+d+NVfyWFQNrk+R + k
  Bostr.8819s0128.1.p  51 PKPRWNPKPEQIRILESIFNSGIVNPPRDEIQRIRIRLQEYGQIGDANVFYWFQNRKSRAKYK 113
                          579********************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.94448113IPR001356Homeobox domain
SuperFamilySSF466894.71E-1150114IPR009057Homeodomain-like
SMARTSM003895.7E-650117IPR001356Homeobox domain
CDDcd000861.45E-751113No hitNo description
PfamPF000461.0E-1452111IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-652111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSSNKNWPSM FKSKPCNNNH HHQYEIDTPS YMHYSNCNIS PSFSSDRVPD PKPRWNPKPE  60
QIRILESIFN SGIVNPPRDE IQRIRIRLQE YGQIGDANVF YWFQNRKSRA KYKLRVHHRN  120
PKMSKKDKII SPGIDADHCF GLVNQEPGLF PVQNNEMVVT EPAGYLSPVQ NDPHAAQSGF  180
GFGDFVVPVA FPDVNNGLEI DETLEKIPAI NFYGGDGNGG GGNCFSPVPL TVPLTTNQSQ  240
ERAVVLSGGE DAGDCVSPVR LTVFINDMPF EIAAGLFNVK EAFGNDAVLI NSFGQPILTD  300
EFGVTFQPLQ NGAVYYLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514000.0AY251400.1 Arabidopsis thaliana WOX8 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279758.10.0hypothetical protein CARUB_v10027735mg
SwissprotQ6X7J50.0WOX8_ARATH; WUSCHEL-related homeobox 8
TrEMBLR0EV120.0R0EV12_9BRAS; Uncharacterized protein
STRINGscaffold_800245.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142621619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.10.0WUSCHEL related homeobox 8